SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489713|ref|YP_003719890.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489713|ref|YP_003719890.1|
Domain Number 1 Region: 90-247
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.9e-25
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00077
Further Details:      
 
Domain Number 2 Region: 357-488
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.88e-24
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00089
Further Details:      
 
Domain Number 3 Region: 225-366
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.74e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0019
Further Details:      
 
Domain Number 4 Region: 4-85
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298489713|ref|YP_003719890.1|
Sequence length 494
Comment precorrin-3B synthase ['Nostoc azollae' 0708]
Sequence
MLSAFYACPGLFYTTPAQDGMLSRIRIPGGILTSEQCGMIANIADNYGGGYIDVTNRANL
QIREIKAAINIEVLQSLQELALGSVNTAVDHIRNIMTSPTAGIDTQELTDTRPLVKAWDN
YITAHSHFSGLSAKFSVCFDGGGKVAVKNCLNDITLAAELLDGDGKTHHVYFRLHLSCGE
KGKPPQDTGILLKPKECIPVLAALADVYLQHTDAKLRRKPRLREVINELGVEQYLQEVEQ
HFKVNNSVCDDKLFFSHSLFTAQEPKRENFLYHLGIYPQRQTGLFYIGVVLPLGRLESLQ
MRGLANLATKYGSCNLRLTPWQNVLITDIPQHKIAEVTQEITSLGLNISSTHINSALVAC
SGKRGCAASATETKDHALALAAYLENHLTLDSPINIHFSGCVKSCAQHDQADITLIGVSS
EAEDKSLEGYQVYVSDGTLRKFGYQLYEYVTFTELPKLISRMLQIYQYQRLSLDESFREF
VYRYGTSQLLQIFS
Download sequence
Identical sequences D7DVF9
WP_013189787.1.25658 gi|298489713|ref|YP_003719890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]