SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489723|ref|YP_003719900.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489723|ref|YP_003719900.1|
Domain Number 1 Region: 561-981
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.67e-136
Family DNA polymerase I 0.0000000128
Further Details:      
 
Domain Number 2 Region: 364-554
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.67e-43
Family DnaQ-like 3'-5' exonuclease 0.00016
Further Details:      
 
Domain Number 3 Region: 19-169
Classification Level Classification E-value
Superfamily PIN domain-like 8.69e-43
Family 5' to 3' exonuclease catalytic domain 0.00005
Further Details:      
 
Domain Number 4 Region: 199-313
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 2.99e-33
Family 5' to 3' exonuclease, C-terminal subdomain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298489723|ref|YP_003719900.1|
Sequence length 982
Comment DNA polymerase I ['Nostoc azollae' 0708]
Sequence
MPLSSFNNLTSDSTISNNPTFILVDGHSLAFRSYFAFAKGKNGGLRTKAGIPTSVCFGFI
KCLLEVITTQKPQAIAVAFDLGLPTFRHEADDTYKADRLETPEDFIPDLENLNELLRGLN
LPIFTAPGYEADDVLGTLSQKASAAGYRVKILSGDRDLFQLIDGDKGITVLNFSPEALKR
YANSITEFQAEQVKEKLGVLPTQIVDFKALCGDKSDNIPGVRGIGEKTAVKLLNTYNSLD
GIYAKLDEITGSTQEKLIAGKEDASHSRYLAQIVVDVPLEVNLEDCQLTGFDTNQLIPIL
EKLEFNKFLDQINELQQKLGGQVLETKAEEINTTQEDDDLWFFSGEDTANTEKRPDSSIQ
IRIINTEDKLQELVAILQKCTNLEKPVAWDTETTALEPRDAALVGIGCCWGTGSDEAAYI
PVGHKIGHNLQLDLVVSALRPILENANYPKTFQNAKFDRLIFKCQGINLVGVVFDTMLAS
YLINPDTTHNLSDLSLRNLGLQLTEYNDIVTKTGKKELQKNIADIGIDIVAYYCGTQVYA
TFQLVDKLRCELNKTPDLAKLLVEVEQPLEAVLAEMEYTGVRINSSYLQELSQQLESELA
KLEIQATEIASEKFNLDSPKQLSYILFDKLGLSTKYSRKIQTGYSTDAATLEKLQEVDNT
GFVDAIIEYRTSSKLKSTYVDALPALVHPQSQRLHTDFNQTATSTGRLSSSNPNLQNIPI
RTAFSRQIRKAFLPESGWLMVAADYSQIELRILAHLSQEPVLVQAYKQNEDIHTVTAKLV
FEKDEVTSEERRFAKTINFGVIYGMGSLKFARSTGVDKANANEFIRRFNERYPQVFAYLE
KVKKEAISQGYVETILGRRRYFDFTSKSLKELKGISLEDIDLSRLKNLGAYNAGLLRSAA
NAPIQGSSADIIKIAMVQLHEVLRNYQARLLLQVHDELVFEVPPQEWGELQLQIKSVMEN
AMSLSVPLVVDVRAGDNWMETK
Download sequence
Identical sequences D7DVE6
gi|298489723|ref|YP_003719900.1| WP_013189797.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]