SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489751|ref|YP_003719928.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489751|ref|YP_003719928.1|
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily CheY-like 7.4e-40
Family CheY-related 0.00043
Further Details:      
 
Weak hits

Sequence:  gi|298489751|ref|YP_003719928.1|
Domain Number - Region: 168-377
Classification Level Classification E-value
Superfamily PP2C-like 0.00915
Family PP2C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298489751|ref|YP_003719928.1|
Sequence length 378
Comment response regulator receiver modulated serine phosphatase ['Nostoc azollae' 0708]
Sequence
MFQILVIDDDYSIQIFLKRMLEKQGYEVITASNGQEGILQALACPPALIICDWIMPGLTG
IEVCDHIKKDPNLSTTFFILLTSLDSVADRVKGLDAGADDFISKPIEQNELQARVRAGLR
LHQLNRDLQSQKLLLETELAEAAEYVKSLLPLPMSAPIAINSRFIPSRQLGGDCFDYYWL
DSDYVAIYLLDTAGHGLRATLPSISVLNLLRSRALKGLNYYQPSQVLTALNDTFQMNYQN
DKYFTIWYGVYDRINRQLTYASAGHPPAILVSGKSPATTELKLLKTPGMPVGMFPEAKYV
DRACRIDNFSSLYIFSDGAYEITKSDGTLWNLDGFIQLLVSLQHSVDYQLEHILNYLINL
NSKEAFDDDLSILQIKFD
Download sequence
Identical sequences D7DYI2
WP_013189825.1.25658 gi|298489751|ref|YP_003719928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]