SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489811|ref|YP_003719988.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489811|ref|YP_003719988.1|
Domain Number 1 Region: 129-348
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-55
Family ATP-binding domain of peptide synthetases 0.00014
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.58e-34
Family D-Alanine ligase N-terminal domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298489811|ref|YP_003719988.1|
Sequence length 351
Comment D-alanine--D-alanine ligase ['Nostoc azollae' 0708]
Sequence
MSKLRVGLLFGGRSGEHEVSIISARGIANALSAEENSHKYEIMPFYIQKDGFWQAGEVAQ
QVLTSGVAKEHPGNRANLWQFPPQTAEIDLWFPILHGPNGEDGTIQALLTLMQVPFVGSG
VLGSATGMDKIAMKTAFAQAGLPQVKYKALTRAQIWSNPCVFPKLCDEIEATLGYPYFVK
PANLGSSVGIAKVQSRQELEAALDNAATYDRRIIVEAGVVAREVECAVLGNDNPKASVIG
EITFDSDFYDYETKYTQGKADLFIPAHLPESAVQQIQEKALQAFTAVDAAGLARVDFFYV
EATGEILINEINTLPGFTSTSMYPQLWANTGISFPKLVDQLIQLAMERHSN
Download sequence
Identical sequences D7DYP2
WP_013189885.1.25658 gi|298489811|ref|YP_003719988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]