SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489840|ref|YP_003720017.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489840|ref|YP_003720017.1|
Domain Number 1 Region: 228-690
Classification Level Classification E-value
Superfamily ADC synthase 8.24e-139
Family ADC synthase 0.000000687
Further Details:      
 
Domain Number 2 Region: 3-190
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.13e-50
Family Class I glutamine amidotransferases (GAT) 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298489840|ref|YP_003720017.1|
Sequence length 731
Comment para-aminobenzoate synthase subunit I ['Nostoc azollae' 0708]
Sequence
MQTLIVDNYDSYTFNLYQMIAEVNGNYPLVIRNNEVTWDELKKIAFDNIVISPGPGRPEK
SEDFGVCRQIIENNVDVPLLGVCLGHQGIGYLHGAKVIHAPEVRHGRISKIHHNESELFQ
GIPSPFSVVRYHSLLVADELPECLEKIAWTEDGLVMGLRHRYLPFWGVQFHPESICTEYG
TTLLNNFRDITLLFTKKLSISSESKYYFPGYQSLYSSVEDMYQQEERFELYTRKLDICPN
TEQIFVHLFQEEPNSFWLDSSRVEPGLSRFSFMGDGKGKNSLLVRYHTQTQELIITQSDK
VTRRTESIFEFLKREIGLRSCQSDELPFDFNCGFVGYFGYELNAECGAKLVHSSPLPDAI
FLLADRMIAIDHEEQCLYLLELVKTGQTQQAGTWFDTIQQQLKILNPLPPLVAQGNGEPV
RLYLSRSYQNYINDIHHCLEEIHEGETYQVCLTNQLHADISPDPLTFYRRLRQINPAPYS
AFLRFGEIAIACSSPERFMQIDRQGWVETKPIKGTLRRGDNPEEDFILQERLRNSEKDQA
ENLMIVDLLRNDLGRVCEVGSVHVPKLMDVETYATVHQLVTTIRGHLPSNLQAVDCIHAA
FPGGSMTGAPKIRTMQIIDRLEQEARGVYSGAIGFLGLNGASDLNIVIRTAIFTPDGTSI
GVGGGIVALSDPEMEFQEILLKAKALIQTMVMTIHGKFEEDLYSILGVESKTSQCFMMFS
NLILKPYNGFF
Download sequence
Identical sequences D7DZE2
WP_013189914.1.25658 gi|298489840|ref|YP_003720017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]