SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298489865|ref|YP_003720042.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489865|ref|YP_003720042.1|
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily GlnB-like 0.0000000000834
Family Prokaryotic signal transducing protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298489865|ref|YP_003720042.1|
Sequence length 97
Comment nitrogen regulatory protein P-II ['Nostoc azollae' 0708]
Sequence
MKIVKRIEILSNSLELQNILKKLDNAGVSGYKIIQHVIGKGNRGRVIDDLEGHGLTNGSI
MNTCSEEREYQVVEAIRPVLKKFGGVCVVSDPKSIIH
Download sequence
Identical sequences D7DZG7
gi|298489865|ref|YP_003720042.1| WP_013189939.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]