SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489880|ref|YP_003720057.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489880|ref|YP_003720057.1|
Domain Number 1 Region: 102-299
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.36e-56
Family BC ATP-binding domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.91e-25
Family BC N-terminal domain-like 0.0094
Further Details:      
 
Domain Number 3 Region: 304-361
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.0000000000000439
Family BC C-terminal domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298489880|ref|YP_003720057.1|
Sequence length 379
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit ['Nostoc azollae' 0708]
Sequence
MSIKRIGIIGGGQLAWMMVHASKKLGIELIVQTPSKNDPAVSIAQAIVLAAVDDAAATEF
LSKKCDVITFENEFVNLDALSLLETQGVCFRPRLAALSPLLDKYHQRCYLRDLGLRVPQF
FALGKSADIQSKIEYLGFPIVLKARRHGYDGQGTFIIHDLATLSTVVNKSNTQLLVEEFV
PFTRELAIIAARSVNGEIVTYPVVETQQEQQVCRRVIAPADITPEQAAEINVIAHIILNS
LQAVGIFGIELFITADGKILINEIAPRTHNSGHFSLDACETSQFEQHLRAVTGLPLTNTS
LNCPSAVMVNLLGYENSHSDYSKQRQKLIDIPQAYLHWYGKTESRPRRKLGHITVLLERQ
SRDMIESIIQTIESIWYPG
Download sequence
Identical sequences D7DZI2
gi|298489880|ref|YP_003720057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]