SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489891|ref|YP_003720068.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489891|ref|YP_003720068.1|
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.69e-21
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298489891|ref|YP_003720068.1|
Sequence length 241
Comment hypothetical protein Aazo_0382 ['Nostoc azollae' 0708]
Sequence
MNRSAPYQPLLLRILHGVSGILVIAAIISGFLVYNTFDKRFGKIPIPKIDPIQDIHGTVG
LFLLLLLPAFTLYSFHAGEKRLLQPDFLQKLSQVGKPIWWVSLQRLTNTLMLIAAVLAVI
SGRMMKEEWLPIGELNHVWYYFHLTAWVIMICCLAIHVLMSAKVVGAPLLLSMLSWKVRH
EDSPKNWFSRLRGWFSNFPNHLQAGINQFVQGSLILRIIEVVVLGGVITAFVLPLFFSAG
E
Download sequence
Identical sequences D7DZJ3
gi|298489891|ref|YP_003720068.1| WP_013189965.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]