SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298489920|ref|YP_003720097.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489920|ref|YP_003720097.1|
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily L21p-like 1.44e-34
Family Ribosomal protein L21p 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298489920|ref|YP_003720097.1|
Sequence length 135
Comment 50S ribosomal protein L21 ['Nostoc azollae' 0708]
Sequence
MTYAIIETGGKQIKVEAGRFYDIELLSTQPDEKVTIDAVLLVQHEGEVSIGQPRVAGATV
EGTVMRHFRGRKVLVYKMKPKKKTRKKRGHRQETTRLLINSINLNGEVLAYQEAPITPEI
PNTMDSIPEEAVAAE
Download sequence
Identical sequences D7E065
WP_013189993.1.25658 gi|298489920|ref|YP_003720097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]