SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490013|ref|YP_003720190.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490013|ref|YP_003720190.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-106
Family BC ATP-binding domain-like 0.0000000127
Further Details:      
 
Domain Number 2 Region: 688-954
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.18e-103
Family BC ATP-binding domain-like 0.000000146
Further Details:      
 
Domain Number 3 Region: 396-553
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 1.31e-55
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000838
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.02e-50
Family BC N-terminal domain-like 0.00000212
Further Details:      
 
Domain Number 5 Region: 555-690
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.04e-45
Family BC N-terminal domain-like 0.00000387
Further Details:      
 
Domain Number 6 Region: 956-1090
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 3.01e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490013|ref|YP_003720190.1|
Sequence length 1094
Comment carbamoyl-phosphate synthase large subunit ['Nostoc azollae' 0708]
Sequence
MPRRQDIRKILLLGSGPIVIGQACEFDYSGTQACKALREEGYEVVLVNSNPATIMTDPET
ADRTYIEPLTPELVAKVIEKERPDALLPTMGGQTALNLAVALSKNGVLDKYNVELIGAKL
PAIEKAENRKLFNEAMGKIGVPVCPSGTASSLEESKEIAHHIGTYPLIIRPAFTMGGTGG
GIAYNQEEFELMAQVGIDASPVSQILIDQSLLGWKEYELEVMRDLADNVVIICSIENFDP
MGIHTGDSITVAPAQTLTDKEYQRLRDMAIKIIREIGVETGGSNIQFAVNPVNGDVVVIE
MNPRVSRSSALASKATGFPIAGIAAKLAVGYTLDEIKNDITKQTPASFEPTIDYVVIKIP
RFAFEKFPGSDSVLTTQMKSVGEAMAIGRTFNESFQKALRSLETGRAGWGCDKSEKLPSA
EQIRAQLRTPNPERVYALRHAMQLGITNEEIYELTAIDPWFLDKLQQILEVEKFLKRTPL
QQLTKEKMYEVKRNGFSDRQIAYATKTKEDEVRAYRQKLGIKPVYKTVDTCAAEFEAFTP
YYYSTYEEETEVLPTDKPKVMILGGGPNRIGQGIEFDYCCCHAAYSLKAAGYETIMVNSN
PETVSTDYDTSDRLYFEPLTKEDVINIIEAENPVGIIVQFGGQTPLKLAIPLQQYLQGRS
CQSPVSSSQSPVPQIWGTSPDSIDMAENRERFENILQELNIAQPPNGIARSYEDALIVAK
RIGYPVVVRPSYVLGGRGMEIVYSDAELERYMTFAVQVEPEHPILIDKFLENAIEVDVDA
IADYTGKVVIGGIMEHIEQAGIHSGDSACSLPSISLSPAVLNQIRTWTVQLAQALSVVGL
MNIQFAVVGANGYSPQVYILEANPRASRTVPFVSKATGIPLAKLASLIMSGKTLEELNFT
QEVIPSHIAVKEAVLPFNKFPGTDTLLGPEMRSTGEVMGIDADFGRAFAKAELGAGEKLP
RKGSVFVSMSDRDKGAAIEVVKEFISLGFTIIATQGTRQVLQQNGVKVDLILKLHEGRPH
VLDAIKNEKIQLIINTPSGEEAQTDARLIRRTGLAYKIPIITTIAGARATVAAIRSLQNT
TLDVKVIQEYCPMG
Download sequence
Identical sequences D7E0F8
gi|298490013|ref|YP_003720190.1| WP_013190086.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]