SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490189|ref|YP_003720366.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490189|ref|YP_003720366.1|
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily Small protein B (SmpB) 9.55e-53
Family Small protein B (SmpB) 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490189|ref|YP_003720366.1|
Sequence length 155
Comment SsrA-binding protein ['Nostoc azollae' 0708]
Sequence
MSDKNEGFKVITDNRQARYLYEILETYEVGIQLTGTEVKSIRAGKVNLKDGYGLIRNGEA
WLINAHISPYTSSGQYFNHEPRRTRKLLLHRQEIRKLIGKVEQQGLTLVPLKMYLQGGWV
KLSIGLGKGKKVHDKREDIKRRQDQRDIQRAMKSY
Download sequence
Identical sequences D7E1L6
WP_013190261.1.25658 gi|298490189|ref|YP_003720366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]