SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490305|ref|YP_003720482.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490305|ref|YP_003720482.1|
Domain Number 1 Region: 109-311
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-58
Family BC ATP-binding domain-like 0.00000299
Further Details:      
 
Domain Number 2 Region: 9-108
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.87e-27
Family BC N-terminal domain-like 0.0000895
Further Details:      
 
Domain Number 3 Region: 318-387
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 7.22e-18
Family BC C-terminal domain-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490305|ref|YP_003720482.1|
Sequence length 389
Comment phosphoribosylglycinamide formyltransferase 2 ['Nostoc azollae' 0708]
Sequence
MKTSLQLPQKLMLLGSGELGKEFVIAAQRLGNYVIAIDRYANAPAMQVADCSEVISMLSA
DDLETVVTKHQPDFIIPEIEAIRTEKLQEFEQRGIIVIPTATATNYTMNRDIIRELAHQE
LGVRTAEYRYAFTLEELITVSDEIGFPNVVKPVMSSSGKGQSVVQDRTEVEKAWSYAISN
SRGDSQKIIVEEFINFEIEITLLTIKQWDAPTIFCPPIGHSQERGDYQESWQPANISEDK
ILASQEIAKKVTDALGGAGIFGVEFFITKDEVIFSELSPRPHDTGMVTLISQNLNEFELH
LRAILGLPIPHIEQLGFSASAVILASEKSDSIAFTGVADALAEKDVDIQLFGKPTAHPYR
RMGVALAKGTDVEDAREKATTAASKVKLI
Download sequence
Identical sequences D7E281
WP_013190377.1.25658 gi|298490305|ref|YP_003720482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]