SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490354|ref|YP_003720531.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490354|ref|YP_003720531.1|
Domain Number 1 Region: 826-1048
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00013
Further Details:      
 
Domain Number 2 Region: 302-514
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.71e-32
Family Multidrug efflux transporter AcrB transmembrane domain 0.00025
Further Details:      
 
Domain Number 3 Region: 48-142
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.97e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0058
Further Details:      
 
Domain Number 4 Region: 144-189,280-337
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000000105
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.01
Further Details:      
 
Domain Number 5 Region: 740-825
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000144
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0091
Further Details:      
 
Domain Number 6 Region: 191-278
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000615
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0042
Further Details:      
 
Domain Number 7 Region: 586-667
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000863
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490354|ref|YP_003720531.1|
Sequence length 1070
Comment acriflavin resistance protein ['Nostoc azollae' 0708]
Sequence
MQITNNNGFSISAISIRQHIATLMLTLAVIVMGVFFIIHLPVDLLPSITYPRIGVRIEAP
GISPEVAINEVTKPLEEAFSATEGVIQVFSRTREGQVSLDLYFQPGGNIDQALNNATATF
NRSRNRLPDTITEPRLFKVDPSQSPVYEFALTSPTLKAVDLRVFAEEELARELGVVPGVA
IVDVSGGVKEEVRVNVDLDRLQSIGVGLTDVLNQLQDRNQDISGGRILGPNSEPLIRTMG
RFQNAEEINNISFEVSARNSNLKNRVYLRDFAQVIDGSEQQRVYVLLNGQEAVKVSIQKQ
PDANTVNVVDGVKKRLEKLKEAGVIPAEATLTSTLDESILIRSSLANLTSSGLIGSGLAA
IAVFLFLGSLRQTLIIILAIPLAFLTAIIFMGIFGLSLNIFSLGGLALGVGIVVDNSIVM
LENIAEGINQSKLQNQTSKLPTALIIQQAEKSSREVESALVASTSTNLVAVLPFLLIGGF
ISLLFNELILTISFAVAASVLIAVTVVPMLTSRLLALPVSSSLGNFWFFREFNHRFEATT
RLYGGLLARILRWRLLTIAITTIILGAGSWWMAPQLPQEILPPINTGQVSLIAQFPPGTP
LETNQKVMRAVDHILRQQPETEYAFSTVGGFLFGSNSTANPLRSSSTITLKPKTDIETYV
ERVTKEFTKLNLVDIRLGLAPGQVRGLILNNSPTRGADVDIILQGNNSDTLEKAGHALLK
TLEEKVTSVRFRPDADVTQPEIQILPDWERVANVGLNTKDIGETIQTAIIGSVATQLQRN
NRLVDVRVELNEASIQTTSQLERLPLFVEGNQQIRLSDVATIAEGKAPGEIQRINQRQVF
LIAGNLAEGASLSQALDQVDLVLKNANFPQGVSLLPSATAESNQELQKSIQLLGGLAIFL
VFVVMAVQYNSLIDPLVILLTIPLALAGGIFGLYITGTAIGATVVVGAVLLVGIVVNNAI
IMVELANQIRERERIDRRTAILKAAPQRLRPIFMTTITTVLGMFPLALGIGEGSEFLQPL
GVVVFSGLSLATMLTLFIIPCFYTLLHDLITGRWAKPVLIKIWKRNLNKA
Download sequence
Identical sequences D7E2N1
WP_013190426.1.25658 gi|298490354|ref|YP_003720531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]