SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490374|ref|YP_003720551.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490374|ref|YP_003720551.1|
Domain Number 1 Region: 301-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-47
Family Ribonuclease PH domain 1-like 0.00000732
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-44
Family Ribonuclease PH domain 1-like 0.000025
Further Details:      
 
Domain Number 3 Region: 460-558
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-26
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.97e-26
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 5 Region: 565-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.12e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 628-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.56e-17
Family Cold shock DNA-binding domain-like 0.00063
Further Details:      
 
Domain Number 7 Region: 236-329
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000235
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490374|ref|YP_003720551.1|
Sequence length 718
Comment polyribonucleotide nucleotidyltransferase ['Nostoc azollae' 0708]
Sequence
MAEVDKSISFDGRDIRLKVGLLAPQAGGSVLIESGDTAVLVTATRSQAREGIDFLPLTVD
YEERLYAAGRIPGGIMRREGRPPERAILTSRLIDRPLRPLFPSWLRDDLQVIAFTLSMDE
QVPPDVLAVTGASIATLIAQIPFNGPMAAVRVGLVGDDFIINPTYAEIDAGDLDLIVAGS
PDGVIMVEAGANQLPERDIIEAIDFGYEAVRDLIQAQLDLVEELGLKIVQEAPPGVDQTL
ENYIHDCASAEIKKILAQFALTKTERDAALDVVKDGIKAEIEALSEEDPIRVAATANSKA
LGNTFKDITKYLMRRQILEDNVRVDGRKLDQVRPVSCQVNVLPKRVHGSGLFNRGLTQVL
SCCTLGTPGDAQNLNDDLQVDQHKRYLHHYNFPPFSVGETKPMRAPGRREIGHGALAERA
ILPVLPPKEQFPYVIRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPILKPVSGAAMGLIK
EGDEVRVLTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKISGLSLEVIAQAVHQAKAAR
LNILDKMLQTIETPRLETSPFAPRLLTIKIDPDMIGLVIGPGGKTIKGITEETGAKIDIE
DDGTVTISAVDEGRAKRARNIVQGMTRKLHEGDVYVGRVTRIIPIGAFVEFLPGKEGMIH
ISQLADYRVGKVEDEVAVGDEVIVKVREIDNKGRINLTRLGIHPDQAAAAREAAAVNR
Download sequence
Identical sequences D7E2Q1
gi|298490374|ref|YP_003720551.1| WP_013190446.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]