SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490672|ref|YP_003720849.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298490672|ref|YP_003720849.1|
Domain Number - Region: 48-248
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0889
Family Clc chloride channel 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490672|ref|YP_003720849.1|
Sequence length 261
Comment hypothetical protein Aazo_1524 ['Nostoc azollae' 0708]
Sequence
MAVKLQPTKNLEQLWIVRCLSTVLLFGQISLHILQGKTYYGKVLEHTVTAGPASLPPVLL
VSGFAGMIFTIQTARELVRFGAVENVGGAFALAFCRELAPILTASIIAGQVGSAFAAEIG
AMRVTEQIDALYMLKTDPIDYLVLPRVIACCLMMPLMMILAVIMGITGGAFAASYFYQVQ
PETFLESVRDFLTPSDVFIILLKGLIFGLIVAVNGCSWGLTTKGGAKEVGESATTAVVTT
WVAIFIMDFILALILFEKPIL
Download sequence
Identical sequences D7E4G8
gi|298490672|ref|YP_003720849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]