SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490713|ref|YP_003720890.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490713|ref|YP_003720890.1|
Domain Number 1 Region: 267-515
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.2e-43
Family Nitrogenase iron protein-like 0.00000205
Further Details:      
 
Domain Number 2 Region: 212-289
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.00000000000000209
Family Domain of the SRP/SRP receptor G-proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490713|ref|YP_003720890.1|
Sequence length 518
Comment signal recognition particle-docking protein FtsY ['Nostoc azollae' 0708]
Sequence
MVFNWFRRQHNDSSDTPEQQPEGETQPIQETQPEPAVETTEDTAELLAFAKAAYKNIQHK
QQAQIQETDSAEEYASISAAIPEETTPEEVATSVTAEVTPVNVSEEPTRQEVAPTSFSQE
TTEVSSLENPATLSFLERAAVERQAKQERLIATAIEVEEAETTPTLASTTSTPDDIEAEI
SELEFDDGFVWSVEVLAAQGRRAEDISMEEITWLKKLRQGLDKTRRNILNQLKAIVGQGP
LNQAAVSEIEALLLQADVGVEATDFMIDALQKKLRDEVTAPDEAIAYLKKILRDMLDAPN
KATEKSTFAPEKDNLSIWLITGVNGAGKTTTIGKIAHLAHKSGYKCLIGAADTFRAAAVE
QVKVWGSRSGVEVIANPGQNTDPAAVVFDAITAAQSRGTELLLIDTAGRLQNKRNLMDEL
SKIRRIIDKKAPNIHVESLLVLDSTLGQNGLRQAEVFSQAAQVSGVVLTKLDGTAKGGVA
LAVVQQLGLPIRFIGAGEGIEDLRPFSSYEFVEALLNG
Download sequence
Identical sequences D7E4K9
WP_013190785.1.25658 gi|298490713|ref|YP_003720890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]