SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490839|ref|YP_003721016.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490839|ref|YP_003721016.1|
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.06e-43
Family Phosphoglucomutase, first 3 domains 0.0014
Further Details:      
 
Domain Number 2 Region: 252-376
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.02e-31
Family Phosphoglucomutase, first 3 domains 0.00084
Further Details:      
 
Domain Number 3 Region: 378-474
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.79e-18
Family Phosphoglucomutase, C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490839|ref|YP_003721016.1|
Sequence length 475
Comment phosphoglucosamine mutase ['Nostoc azollae' 0708]
Sequence
MSNPSNSGKIKFGTDGWRGIIADDFTFPNVRKVTRAIASYLETAYSKDRPVLIAYDTRFL
ADEFARTSAAVLADLGWNVKITDRDCPTPVIAYNARHLNSAGALMFTASHNPAPYCGIKY
IPDYAGPATPEITDTIVANIETASDELPGSNPSGTISIFDPKPDYLHFIYTLLDVEKIKG
ANLKVKYDALYSTSRGYLDEVLEHCGTQLESFHIWRDVLFGGGMPEPKGEQLVELVEAVK
TDKADLGLATDGDSDRFGIVDEQGNVLTPNTVLLVLARHLIKNKGKTGAIVRTVATTHLL
DNFAAKYGLQIYETAVGFKYIGEKMRETAVLIGGEESGGLSIIGHIPEKDGVLADMLVAE
AIAYEGKPLSQLVQEAITEADGPLYNNRLDLHLTESHKNAVIDSFTLMPPSEVAGIKVKE
VGRKDGIKLYLEEGSWVLLRPSGTEPLVRVYMETNSPEKLSQIAATMEAEIAKLA
Download sequence
Identical sequences D7DVN4
WP_013190911.1.25658 gi|298490839|ref|YP_003721016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]