SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491033|ref|YP_003721210.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491033|ref|YP_003721210.1|
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.82e-74
Family Cytidylytransferase 0.012
Further Details:      
 
Domain Number 2 Region: 247-431
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 5.41e-30
Family YdcK-like 0.061
Further Details:      
 
Domain Number 3 Region: 636-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.79e-18
Family Phosphoglucomutase, first 3 domains 0.0094
Further Details:      
 
Domain Number 4 Region: 371-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000647
Family Phosphoglucomutase, first 3 domains 0.0036
Further Details:      
 
Domain Number 5 Region: 531-632
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000204
Family Phosphoglucomutase, first 3 domains 0.0042
Further Details:      
 
Domain Number 6 Region: 745-830
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.000000000288
Family Phosphoglucomutase, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491033|ref|YP_003721210.1|
Sequence length 842
Comment nucleotidyl transferase ['Nostoc azollae' 0708]
Sequence
MRGVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKRHHITEIIATLHYLPDVL
RDYFQDGSDFGVQMTYAIEEDQPLGTAGCVKNIAELLDETFLVISGDSITDFDLTAAIKF
HKQKQSKATLILTRVPNPIEFGVVITDEQGRINRFLEKPSTSEIFSDTVNTGTYILEPEV
LEYLPEHTESDFSKDLFPLLLATNEPIYGYVAQGYWCDVGHLDAYREAQYDALARKVKLE
FAYQEASPGVWIGQNTYIDPSAKIQTPAVIGDNCRIGARVQIDDGTVIGDNVTIGADANL
KRPIVWNGAIIGDEAQLSACVISRGTRVDRRSHVLEAAVVGSLSTVGEEAQISPGVRVWP
SKKIESGAILNINLIWGNTAQRNLFGQRGVQGLANIDISPEFAVKLGAAYGSTLKPGSKV
TVSRDQRNVSRMVTRSLIAGLMSVGVDIQNLDSTAIPITRTVIPIMGVVGGIHVRVHPDR
PDYILIEFMDGKGINISKAQEKKIEGAYFKEDMRRAQSHEIGDVAYPSQVIDRYCTAFEK
LLNVSTLRNSRAKVVIDYVYAVSGAVLPQMLDKFGADAVVLNASVNKTAMTTTSREGLLT
QLGHVVEALKANFGVQVSANGEQLILVDESGYPVRGEILTALMVEMMLTSNPRCSVVVPV
HASSAVEQVARRHDSKVIRTKANPTALMEACQKNPNVVLGGSGETGFIFPQLHPGFDSMF
CIAKLIEMLTIQERSLASVRSELPRVIHKDYTIRCPWTAKGALMRYLVETHPAQNLELID
GVKIRQPYDDSWVLVLPDASEPMVHLFANSSDRDWVDESLRSYRHRVQTFVEREQEHYTA
EV
Download sequence
Identical sequences D7DWH0
WP_013191104.1.25658 gi|298491033|ref|YP_003721210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]