SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491061|ref|YP_003721238.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491061|ref|YP_003721238.1|
Domain Number 1 Region: 50-332
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.22e-78
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000199
Further Details:      
 
Domain Number 2 Region: 318-417
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000000397
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491061|ref|YP_003721238.1|
Sequence length 418
Comment tyrosyl-tRNA synthetase ['Nostoc azollae' 0708]
Sequence
MNIINLTSQVQSVVNNESSSMTQNFSWLHRGVAEIFPQPHDDDHETESLEKRLVNANRPL
RVKLGIDPTGADIHLGHSIPVRKLRAFQDAGHTAVLIIGDFTARIGDPTGKSHVRCQLTE
GDVAQNAQTYLDQVRPILDFDTPGSLEVRYNSEWLSRLDLGKVLQLLSTMTVGQMLAKEG
FAERYKKENPIFLHEFLYPLMQAYDSVATEADVELGGTDQKFNIAVGRDLQRHFGLKPQF
GLLLPILIGTDGVRKMSKSLNNYVGLSEHPSQKYQKIQAVPDNLLSQYFELLTDLPLDSL
PENPRARQEFLAWEIVRQYHGEVAATEAKEAAKSGGKEGTLLEFSLAAIVQFPVKLAFIL
GATGLCKSTAEGKRKIQEGGVRLDGEKVTDADTTFAAPGDLYFKVLQVGKKNFVRLVE
Download sequence
Identical sequences D7DWU2
gi|298491061|ref|YP_003721238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]