SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491081|ref|YP_003721258.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491081|ref|YP_003721258.1|
Domain Number 1 Region: 3-427
Classification Level Classification E-value
Superfamily L-aspartase-like 1.73e-130
Family L-aspartase/fumarase 0.000000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491081|ref|YP_003721258.1|
Sequence length 431
Comment adenylosuccinate lyase ['Nostoc azollae' 0708]
Sequence
MIERYTLPEMGNLWSEAYKLKTWLQVEIAVCEAQAELGYIPSEAVAEIKAKANFDPKRVL
EIEAEVRHDMIAFLTNVNEFVGDTGRYIHLGLTSSDVLDTALALQLIASLDLLLQCLEDL
IQAIRHKAREHRYTVMIGRSHGIHAEPMTFGFKLAGWLAEVLRHQERLQILQKTIAVGKI
SGAVGTYANIEPRVEALACQKLGLKTDTASTQVISRDIHADYVQQLALVAASIERFAVEI
RNLQKTDVLEVEEFFAKGQKGSSAMPHKRNPIRSERLTGMARLLRSHAGAVLENVALWHE
RDISHSSVERVVLPDACILTHFMLHEITDLVTNLLVYPQNMERNLNCYGGVVFSQRVLLT
LIDKGLNREEAYAIVQQSAHTAWNKPEGNFRDLISKDPRVTQKLSPPEIDACFDPQHHLR
HLDQVYQRLGI
Download sequence
Identical sequences D7DWW2
gi|298491081|ref|YP_003721258.1| WP_013191152.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]