SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491203|ref|YP_003721380.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491203|ref|YP_003721380.1|
Domain Number 1 Region: 132-313
Classification Level Classification E-value
Superfamily alpha/beta knot 1.18e-47
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000264
Further Details:      
 
Domain Number 2 Region: 62-141
Classification Level Classification E-value
Superfamily L30e-like 5.53e-20
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491203|ref|YP_003721380.1|
Sequence length 323
Comment TrmA family RNA methyltransferase ['Nostoc azollae' 0708]
Sequence
MTNQPRKINITGETKRVQPIKIKGKRVIANPTRHQTKGESKSFSSKPRPSHQSSLPTPAI
KSPEESDLIYGRHPVLSALENQRGLNRLWITARLRYDPRFHHLILQAKDNGTVIDEVEPK
RLDQITDGANHQGIAAQIAPYAYMELEDLITQAKSVTDPVIVVADGITDPHNLGAIIRTA
EAIGSQGLVIPQRRASGITSTVVKVAAGALENFPVARVINLSRALEQLKEAGYWIYGTAA
AGSEPIHTVKFSGSTVLVIGSEGDGLSMLTQRSCDILVSIPLQGKTPSLNASVAAGMALY
EIYRQRSLNTLYLDKLRTISLKK
Download sequence
Identical sequences D7DXI1
WP_013191274.1.25658 gi|298491203|ref|YP_003721380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]