SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491414|ref|YP_003721591.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491414|ref|YP_003721591.1|
Domain Number 1 Region: 87-166
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-24
Family Translational machinery components 0.00035
Further Details:      
 
Domain Number 2 Region: 16-83
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.24e-19
Family Ribosomal S5 protein, N-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491414|ref|YP_003721591.1|
Sequence length 174
Comment 30S ribosomal protein S5 ['Nostoc azollae' 0708]
Sequence
MAAGRRKANRAKKEETNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNERGQVGVGVGKA
SDVIGAVKKGVADGKKHLIDIPITKSNSIPHPIDGIGGGAKVMMRPAAPGTGVIAGGAVR
TVLELAGVRNVLAKQLGSNNPLNNARAAVNALSTLRTFAEVAEDRGIAIEKLYI
Download sequence
Identical sequences D7DYY9
gi|298491414|ref|YP_003721591.1| WP_013191485.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]