SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491527|ref|YP_003721704.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491527|ref|YP_003721704.1|
Domain Number 1 Region: 270-530
Classification Level Classification E-value
Superfamily PP2C-like 2.88e-46
Family PP2C-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491527|ref|YP_003721704.1|
Sequence length 664
Comment protein serine/threonine phosphatase ['Nostoc azollae' 0708]
Sequence
MENDAVTLSCPNEYCQAANPLTHKFCQRCSTPLPKRYLWVVADSLNLVSPGEILADRYLV
IGQSIIFDLKPGLVPQIPELDNLDRIRAYLKLIPYRLNIPQVYGMLSLDERQSQPKILLL
EKPPILVDSTDSQVYLCSKLTRDWGDASSMRQMNWLWQIAHLWEPLLTEGVASSLLDPHL
LRVEGALVRLLELHFDSPTVPTLSQLGAFWEQLLKDAKPAIAEFLKQISDGLIHGEISSS
EQLIAVLDQGLAGLGTASSGRNAPTQNTTIKIITQTDTGPSRQRNEDACYPPRGLVVSKP
PQQTALAIVCDGIGGHEGGNIASNLAIETIQQQIIQLTSVPYENIDPLLLLNDLEQAVSL
VNEKISHRNDTEHRQGRQRMGTTLVMALPIAHEMYITHIGDSRAYWITRHGCYQVTLDDD
VASREVRLGYTIYREALQHSGSGSLVQALGMSKSASLHPTSQRFIIDEDAVFLLTSDGLS
DFDRVEECWETEILPILAGETNIENVASRLIEIANTKNGHDNVTIALVHYQINYSEPDII
LKAAIPTISASKTVDLTPKVANGIDLGDFHQQTQVIQEAKPARTSQLPLQLLIILGILLA
AGSLGYWLKMQRQLPSTIVDPATPSPSPQLETRTTPRPMTTPRPIPLETPDNLPSPVVQT
PDSQ
Download sequence
Identical sequences D7DZU9
WP_013191597.1.25658 gi|298491527|ref|YP_003721704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]