SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491612|ref|YP_003721789.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491612|ref|YP_003721789.1|
Domain Number 1 Region: 35-497
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.09e-165
Family Type II DNA topoisomerase 0.00000000103
Further Details:      
 
Domain Number 2 Region: 531-832
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.44e-67
Family GyrA/ParC C-terminal domain-like 0.000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491612|ref|YP_003721789.1|
Sequence length 835
Comment DNA gyrase subunit A ['Nostoc azollae' 0708]
Sequence
MAKQLNLLSTGQVITTALHTEMQRSYLEYAMSVIVGRALPDVRDGLKPVHRRILYAMHEL
GLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRLVQEFSSRYPLLAGHGNFGSVDND
PPAAMRYTETRLAPVGHEGMLTEIGEETVEFIGNFDNSQQEPTVLPAQLPFLLLNGCAGI
AVGMATNIPPHNLGEVVDGLIVLIDNPDLTDEKLFEIIPGPDFPTGGEIVGNSGIREAYT
TGKGGIVLRGVATLEEMLPTKGSKRRTAIIITELPYQVNKAGWIEKVADLVNQGRLQGIS
DLRDESDREGMRVVIELKRDTNPQEILQHLYHQTALQTTFGAILLALVEGQPRQLSLRQT
LQEFLNFREHTLNRRYSYELGKAENRVNLVAGLLKALSKLDEVIAILRQAADGSTAKMNL
CRQLDLSEVQADAILSMPLRRLTSLEQQNLQQEFDSLNEQITSLRRLLEDRRELLKALKK
DLRSLKRKYSDPRRTKILAINETPIKSEKGTTETEDNPKSKLQTPKSEQPPEEAILEFTQ
RGYVRRLSPTGKKPKAENGLHENDFIIQTELTDTEKDLLILNTGGKVYPVKVGDIPAITG
RSPRGTPLITMLTSTAQGNVEGVVNRFVLPETPERSQMLLLTKQGRIKRLSMEEFANLSR
RGITILKLKDDDELSFTQFTTTGQHLILASSSGRLLRFAVNEEQLPIMGRAAMGLQAFRL
LKNQQMVGCATVGKDDQLLLVTQEGYAKRIPASNLRAANRGDLGIQMLKFHNKTDNLAGM
VRATPGVEVALVSNKERVVRIPVDTVPILDRDAKGESVLQLNRDEKIITVVEVGV
Download sequence
Identical sequences D7E0L0
gi|298491612|ref|YP_003721789.1| WP_013191682.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]