SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491628|ref|YP_003721805.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491628|ref|YP_003721805.1|
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily CheY-like 2.28e-28
Family CheY-related 0.0016
Further Details:      
 
Domain Number 2 Region: 143-312
Classification Level Classification E-value
Superfamily GAF domain-like 7.85e-20
Family GAF domain 0.0053
Further Details:      
 
Domain Number 3 Region: 333-489
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000366
Family PP2C-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491628|ref|YP_003721805.1|
Sequence length 557
Comment GAF(s) sensor(s)-containing protein serine phosphatase ['Nostoc azollae' 0708]
Sequence
MTETEVEKLKLMVVDDEPDNLDLLYRTFWRTFKVYKANDAHEALAILDQVGEMAVIISDQ
RMPEMNGTELFSRTVERFPDTIRILLTGFTDVEDLVDAINSGQVFKYITKPWKPDQLKAL
VEQGKDTYRLVKKRTKELRHALRRESLFNAVTTTIRESLDYNSILQKIVVTIGQTFTATS
CVLRLVEGDRLTPNQFFYHDPKFSDITLPFDSNPLIEEVLYTQKYQLTQDTHHDNSSHSL
VVPFTYQQHLLAVMTLYKWGSENIWQDEDIQMITGVAEQAALALSQAKLYQSLQEKQQQI
RVELQVARQIQNNLLRQTLPEIDGVKIQACCYPAREVGGDFFEVFVHPKGDLWLAVGDVS
GKGVPAALFMASAISLLRRELSQESPAEPNIVMQNLNYALADDLMSNNYFITLVIATYNK
VTKELVYANAGHIYPLLWSHQATLVTQPYYLKERSIPLGILPKWHANPGRFTLAPGDTLL
LASDGITEAKVSKKPHLHKDNNGICQQTHSSMLNQEGLWQLIQEEPQPLSLENLLNRIQT
DNHVQEDDQTILSLEVL
Download sequence
Identical sequences D7E0M6
gi|298491628|ref|YP_003721805.1| WP_013191698.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]