SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491772|ref|YP_003721949.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491772|ref|YP_003721949.1|
Domain Number 1 Region: 3-309
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.21e-105
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000919
Further Details:      
 
Domain Number 2 Region: 311-473
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 2.22e-36
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491772|ref|YP_003721949.1|
Sequence length 481
Comment glutamyl-tRNA synthetase ['Nostoc azollae' 0708]
Sequence
MSVRVRIAPSPTGNLHIGTARTAVFNYLFARHHDGKFILRIEDTDLERSRPEYTDNILSG
LRWLGLNWDEGPFFQSQRLHLYREAVQKLLDQGLAYRCYTTFEELDALRETQKARNEAPR
YDNRHRNLTPEQRAAFEAEGRSSVIRFKVEDKRQIVWNDLVRGQMSWCGSDLGGDMVIAR
ASADGIGQPLYNFVVVVDDIDMEITHVIRGEDHIANTAKQLLLYEALRAKTPEFSHTPLI
FNQEGRKLSKRDGVTSISDFQKMGFTAEGLVNYMTLLGWSAPDSTQEIFTLESAAKEFTF
ERVNKAGAKFDWDKLDWINSQYIHNMDVVHLTDLLIPFWQEAGYSLTYGRERPWLEQLVS
LIAASLTRLVDAVPMTKIFFTEGVEFTEEGLSQLQQEGVKATLKAILTALENQPQLSPYT
AQDIIKQVVKEQKVKKGLVMRALRAALTGDVHGPDLIQSWLLLNHISLDKQRLNQVISAA
N
Download sequence
Identical sequences D7E1Q5
gi|298491772|ref|YP_003721949.1| WP_013191841.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]