SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491819|ref|YP_003721996.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491819|ref|YP_003721996.1|
Domain Number 1 Region: 16-257
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000000000301
Family PP2C-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491819|ref|YP_003721996.1|
Sequence length 260
Comment protein serine/threonine phosphatase ['Nostoc azollae' 0708]
Sequence
MNIPKQITKWRIVAASVCGTSHIKNQQLCQDAHHWQVLANNVLVIAAADGAGSATLGKMG
AMIAVETATEYISHSEISHKTFAEDGFLRDLLTDAMLAAKKAVEDQADLYHHQPHDLATT
LIIAIATPKIVAVAQIGDGLAVAKDSRGNLIALTIPSSGEYINETTFLTSPDALDTAQFR
ILRQEIVNLSVLTDGLQMLALNMLVGEPHKPFFFPLFDFVANAEDKTIAKEQLIKFLCSE
RITQRTDDDLTLVIAALRKP
Download sequence
Identical sequences D7E1V2
WP_013191888.1.25658 gi|298491819|ref|YP_003721996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]