SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491825|ref|YP_003722002.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491825|ref|YP_003722002.1|
Domain Number 1 Region: 495-977
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-149
Family ALDH-like 0.00000000199
Further Details:      
 
Domain Number 2 Region: 129-456
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.14e-89
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491825|ref|YP_003722002.1|
Sequence length 990
Comment delta-1-pyrroline-5-carboxylate dehydrogenase ['Nostoc azollae' 0708]
Sequence
MMLQVQNGTYESKTQEIAKEFLAATQENRSFLASLGDQMRWDDKLLAWAMSNPGLRVQLF
RFIDTLPALNSKAEIASHLQEYLGDQLVELPAALKGMLNFANADSMPAQVAARTVETAVQ
TLAHKYISGENISQVIKTLERLRKEKMSFTIDLLGEAVITETEAESYLHRYLDLMQQLVA
ASKNWANIPSIDEADGQKVPKVQVSVKLTAFYSQFDPLDAQGSEEKVSARIRILLRRAQE
LGAAVHFDMEQYAYKDITFNILKKLLLEEEFRQRTDIGMTIQAYLRDSEQDARDIIAWLK
QRGYPLTIRLVKGAYWDQETIKAEQKHWLQPVYNDKATTDANFEAITEILLENHQYVYSA
IGSHNMRSQSRAIAIAETLQLPRRCLELQVLYGMGDKIAKALVDKGYRVRVYCPYGDLLP
GMAYLIRRLLENTANSSFLRQSLENRPVEELLAPPIPSSPSLAGGIEGRFISVADTDFAE
EKKRNKSSLAFAGVRQQLGKTYLPFVNGEYVNTTTFVDSLNPSNFSEVVGKIGLLSIQQA
EQAMQAAKAAFPAWKKTPVKERADILRKAADLMEQQRAELSAWMVLEVGKPVKEADAEVS
EAIDFCLYYANEIERLDKGVIYDVSGETNRYIYQPKGIAVVISPWNFPLSIACGMTVAAL
VSGNCTLLKPAETSSVITAKLTEILIAAGIPKSVFQHLTGKGSQVGAYLVNHPDTHVIAF
TGSQEVGCRIYAEAAILKPGQKHLKTVIAEMGGKNALIVDESADLDQAVIGVVQSAFGYS
GQKCSACSRVIVLEPIYHAFLQRLVEATKSLNIGEAELPSTQVGPVIDVNARARILEYIE
IGKKEATLALELPAPNQGYFIGPVIFSEVPANGVIAQQEIFGPVLAVIRVKDFQEALEVG
NGTNYALTGGLYSRTPSHIQQAQAEFEVGNLYINRTITGAIVGRQPFGGFKLSGVGSKSG
GPDYLLQFLEPRHITENIQRQGFAPIEVSE
Download sequence
Identical sequences D7E1V8
WP_013191894.1.25658 gi|298491825|ref|YP_003722002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]