SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491874|ref|YP_003722051.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491874|ref|YP_003722051.1|
Domain Number 1 Region: 157-456
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 4.27e-85
Family NadC C-terminal domain-like 0.0000273
Further Details:      
 
Domain Number 2 Region: 24-156
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 4.86e-40
Family NadC N-terminal domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491874|ref|YP_003722051.1|
Sequence length 458
Comment nicotinate phosphoribosyltransferase ['Nostoc azollae' 0708]
Sequence
MTTFIDVGYGYQNPELNLSQEDYSMLTDLYQLTMAACYTGEGIEQKRASFELFVRHLPNG
FGYLIAMGFAQALEYLAKFRFNSAQIAALQETGIFTHVPERFWSLLAEGAFTGDVWALPE
GTAVFANEPFLRVEAPLWQAQLVETYLLNTINYQTLIATKAARLRDIAGEKVTLLEFGTR
RAFSPQASLWAARAALASGLDATSNVLAAIQLDQKPSGTMAHALVMALSALEGSEEQAFT
AFHQYFPGAPLLIDTYDTVAAAQKLALKVKTGEMKLTGVRLDSGDLVSLSKTVRALLPEV
SIFASGDLDEWEIQRLKTEGAEIDGYGLGTKLVTGSPVNGVYKLVDVDGIPVMKMSSGKF
TYPGRKQIFRSFTGSKLQADKLGLSYENNSDKKPLLQLVMKEGKQLQKPESLTTVRQRTE
FSVASLSEEIRRLKNPISLKVEISQMLLNLTEETKEKH
Download sequence
Identical sequences D7E2A6
WP_013191943.1.25658 gi|298491874|ref|YP_003722051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]