SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491903|ref|YP_003722080.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491903|ref|YP_003722080.1|
Domain Number 1 Region: 5-224,345-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-82
Family Tandem AAA-ATPase domain 0.000000132
Further Details:      
 
Domain Number 2 Region: 706-924
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 5.1e-73
Family Helical scaffold and wing domains of SecA 0.00000894
Further Details:      
 
Domain Number 3 Region: 395-502,605-704
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4e-52
Family Tandem AAA-ATPase domain 0.00000632
Further Details:      
 
Domain Number 4 Region: 223-345
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 2.09e-45
Family Pre-protein crosslinking domain of SecA 0.0000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491903|ref|YP_003722080.1|
Sequence length 930
Comment preprotein translocase subunit SecA ['Nostoc azollae' 0708]
Sequence
MLKLLLGDPNARKLKKYQPYITEINLLEEEIKALSDDELKGKTAEFRQRLAKGETLDDIL
PEAFAVVRESGRRVLGLRHFDVQLLGGVILHSGQIAEMKTGEGKTLVATLPSYLNALTGQ
GVHVITVNDYLARRDAEWMGQVHRFLGLSVGLIQATMNPTERKKNYDCDITYVTNSEIGF
DYLRDNMATSMPEVVQRPFNYCVIDEVDSILVDEARTPLIISGQVERPTEKYLQAAEIAF
TLQKDEHYDVNEKDRNVILTDEGFAEAESLLGVTDLFDPENPWAHFVFNAIKAKELFLKD
VNYIVRNDEVVIVDEFTGRVLPGRRWSDGLHQAIEAKEHVEIQPETQTLATITYQNLFLL
YPKLGGMTGTAKTEEVEFEKIYKLEVTVIPTNRIRRREDLSDMVFKTEPGKWRAIAKECA
EMYENGRPVLVGTTSVEKSELLSRLLKEINIPHELLNARPENVEREAEIVAQAGRRGGVT
IATNMAGRGTDIILGGNSEYMARLKLREYFMPRIVSPEDEDVFSMQRASGLPMAASGGAQ
GFVPGKKVKTWRASPEVFPTQLSKETEQLLKEAVEVAVKAYGSRSLPELEAEDKVAVAAE
KAPTDDPVIQKLREAYQRIKHEYEEFTSSEHDDVVSRGGLHVIGTERHESRRIDNQLRGR
AGRQGDPGTTRFFLSLEDNLLRIFGGDRVAGLMNAFQVEEDMPIESGMLTRSLEGAQKKV
ETYYYDIRKQVFEYDEVMNNQRRAIYAERRRVLEGQDLKEQVIKYAEKTMDDIVNYYINP
DLPSEEWELEKLVEKVKEFVYLLADMQASQLEDMGVSEIKAFLHEQARIAYDMKEAQIDQ
IQPGLMRQAERFFILQRIDTLWREHLQQMDALRESVGLRGYGQKDPLIEYKSEGYELFLD
MMVNIRRDVVYSLFMFQPQPQPTVQTSEIV
Download sequence
Identical sequences D7E2D5
WP_013191972.1.25658 gi|298491903|ref|YP_003722080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]