SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298491926|ref|YP_003722103.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491926|ref|YP_003722103.1|
Domain Number 1 Region: 220-336
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 7.06e-32
Family DRTGG domain 0.00038
Further Details:      
 
Domain Number 2 Region: 6-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.98e-30
Family Nitrogenase iron protein-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491926|ref|YP_003722103.1|
Sequence length 371
Comment DRTGG domain-containing protein ['Nostoc azollae' 0708]
Sequence
MPTSFKYLLIGSIETYSGKSATVLGLSDQLKQKGLDIAYGKPLGTCLHNADGTLVEEDVQ
FITQNLKLSENHVAPTLLALDEVRVQKRLRGEDQTNYQQSLIQHYLEVPRGDLMLLEGGG
NLAEGNLFGLSLLQVAQVLDTAVLLVHRYGSLLSVEALLSAKKQIDDACGRQRQRLIGVV
INEVPTEQLEAGNSLLRPFLEQQGIPVLAMLPKSDLLRSVSVEELVKQLGAEVLCRSDRL
DLLVESLAIGAMNVNAAVKYFRKRRNKAVVTGGDRVEIQQAALETSTQCLILTGQLPPPA
FILNRAEELEIPILSVDLDTLTTVEIVHRTFGQVRVHEPLKVECICQLMSEHFDINRLLS
QLGLNPAAAVS
Download sequence
Identical sequences D7E2F8
gi|298491926|ref|YP_003722103.1| WP_013191994.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]