SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298492176|ref|YP_003722353.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298492176|ref|YP_003722353.1|
Domain Number - Region: 20-63
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0549
Family FtsH protease domain-like 0.018
Further Details:      
 
Domain Number - Region: 101-124
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0615
Family Delta-sleep-inducing peptide immunoreactive peptide 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492176|ref|YP_003722353.1|
Sequence length 126
Comment hypothetical protein Aazo_3668 ['Nostoc azollae' 0708]
Sequence
MPGFGDIVQKAFYLGVGLASYAGEKARGKLAELRSEVQKLADEMVAKGEMNTEEARHFVE
DMMNQAHQPPRSGETTEKTAPSEPRRIEILEVDEELTVKEAPKENVDHLRQQVLELQQEL
KQLKKS
Download sequence
Identical sequences D7E3R1
gi|298492176|ref|YP_003722353.1| WP_013192244.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]