SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492346|ref|YP_003722523.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298492346|ref|YP_003722523.1|
Domain Number - Region: 15-73
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.0562
Family Hypothetical protein PA1324 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492346|ref|YP_003722523.1|
Sequence length 185
Comment hypothetical protein Aazo_3894 ['Nostoc azollae' 0708]
Sequence
MRQLVKFAIGTITFLSCLQGTLSAQALTYQFNWTGENGYSATGNFSFNDLDNDGIARANN
SNNFNEFTVFNITFRELVTNSLATLATYDLNQLQSFNPTFNFNYDFVNNVVLQTGNFSDA
DGFSISDGHNGFFLTRNGKDRISFGETDETFFDFSGIVTATPIPFEFSPTLSLSILSAVF
AIQKG
Download sequence
Identical sequences D7E4T4
gi|298492346|ref|YP_003722523.1| WP_013192412.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]