SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298492399|ref|YP_003722576.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492399|ref|YP_003722576.1|
Domain Number 1 Region: 183-643
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.34e-119
Family Amylase, catalytic domain 0.0000000054
Further Details:      
 
Domain Number 2 Region: 651-754
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.35e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.0003
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily E set domains 1.03e-18
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 
Domain Number 4 Region: 141-197
Classification Level Classification E-value
Superfamily E set domains 0.0000000139
Family E-set domains of sugar-utilizing enzymes 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298492399|ref|YP_003722576.1|
Sequence length 763
Comment 1,4-alpha-glucan branching protein ['Nostoc azollae' 0708]
Sequence
MSISAIASEQVNRIVWNQHHDPFEVLGSHLIEQNGKNVWAVRAYLPNASAAWVVVPENRK
EYPMYTVHDPHFFECTIETPELSNYQLRIKEGEHELVTYDPYAFRSPHLTDFDLHLFGEG
NHHRIYEKLGAHLTEVDSVKGVYFAVWAPNARNVSVLGDFNLWDGRKHQMRKGDTGVWEL
FIPELGMGEHYKYEIKNFEGHIYEKSDPYGFQQEPRPKTASIVTDLNSYTWNDENWMEVR
RQTDPLTQAISVYEVHLGSWLHAASSEPAKLPNGETQAVVPVSELNPGARFLTYRELAER
LIPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGSPEDFMYFIDQCHQNGIG
VLVDWVPGHFPKDGHGLAFFDGTYLYEHADPRKGEHKEWGTLVFNYSRNEVRNFLAANAL
FWFDKYHIDGIRVDAVASMLYNDYCRKEGEWLPNQYGGRENLEAADFLRQVNHTIFSYFP
GVLSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDKWQKLANVRALFAYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWHLFQYEPHQQLKDFFQSLNHLYRSEPALYTQDFAREGFEWVDCSD
NRHSVVSFVRRAKDSDEFIVVVCNFTPQPHSHYRIGIPEKGFYTELFNSDARQYGGSNMG
NLGGKWTDDWSLHNRPYSLDLCLPPLGVLMLKLDKQKMAEVMK
Download sequence
Identical sequences D7E4Y7
gi|298492399|ref|YP_003722576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]