SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298492403|ref|YP_003722580.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492403|ref|YP_003722580.1|
Domain Number 1 Region: 1-240
Classification Level Classification E-value
Superfamily PP2C-like 1.57e-63
Family PP2C-like 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298492403|ref|YP_003722580.1|
Sequence length 244
Comment protein serine/threonine phosphatase ['Nostoc azollae' 0708]
Sequence
MKLNFTGCTDPGLIRSNNQDAFYIDQEGRFFIVADGMGGHAGGEEASRIATQEITAYLLA
NWESFQSATQLLEQALWSANKAILQDQENHPERGDMGTTAVVVVFRSQEQPLCAHIGDSR
LYRFRESQLQQITEDHTWIARAIKIGDITADEARVHPYRHVLSRCLGREDLHHVDLQPLD
VKVGDRLLLCTDGLTEELVDPKISRCLQDTPDLDKIAISLVEAAKEEGGHDNITVILVAV
EENF
Download sequence
Identical sequences D7E597
gi|298492403|ref|YP_003722580.1| WP_013192469.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]