SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298492439|ref|YP_003722616.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492439|ref|YP_003722616.1|
Domain Number 1 Region: 374-632
Classification Level Classification E-value
Superfamily PP2C-like 5.36e-49
Family PP2C-like 0.00016
Further Details:      
 
Weak hits

Sequence:  gi|298492439|ref|YP_003722616.1|
Domain Number - Region: 5-55
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00192
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492439|ref|YP_003722616.1|
Sequence length 642
Comment protein serine/threonine phosphatase ['Nostoc azollae' 0708]
Sequence
MLICPHCQFENPNDNKFCQNCGTSLTHRACYKCGYEVSVDTQNCQNCGAECGTIWWAIIT
QETPVIVSEFGHALTQMQGNINSQPQSAVGSFLDREQRYQLLAPLPSREVMATNTELKVR
VLDCQPYQISPIEAMLGNQPDGLIVPSLSVIGIPNLAKAYVVLQPETPSVIPLIHDAWQQ
DNIQVILIEDRSHWQLLLDAWQDQTTHPLQILHWCYQMIHLWGVLERVNCRQSLLELSNL
RLDEDQTLGLQRLHLEIPGSNLSEHAEQPLTIKALGRVWQTLCKQSQRTQIGSVVKMLED
LEIGKIENLEELRSRLEEIATELEPPANHDFSSTEAKYPSASTILQDDDDGEEIDKNEDA
PTIILSMQLRSVENTGRTDVGRQRNHNEDYFGINSKQQKLELPRSRNLQARGLYILCDGM
GGHAAGEVASELAVSTLQQYFQENWVTAELPTAESIQKAVFLANETIYNLNQQGLRSGVG
RMGTTLVMLLMHNTRAAVAHVGDSRLYRCTGQRGLEQITVDHEVGQREIAKGVESAIAYA
RPDAYQLTQAIGPRDANFVHPEVDFFEISEDTLLLLASDGLSDNDLVENNWQTHLEPLLS
SGANLESGLNNLIDLANEYNGHDNITGILIRVKVSPNQQSWH
Download sequence
Identical sequences D7E5D3
gi|298492439|ref|YP_003722616.1| WP_013192505.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]