SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298492489|ref|YP_003722666.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492489|ref|YP_003722666.1|
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.0000000000248
Family Subunit XII of photosystem I reaction centre, PsaM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492489|ref|YP_003722666.1|
Sequence length 31
Comment photosystem I reaction center subunit XII ['Nostoc azollae' 0708]
Sequence
MPISDTQVYIALAVALIPGILAWRLATELYK
Download sequence
Identical sequences A0A161VRZ0 A0A1B7UZE9 A0A1B7WIR3 A0A218Q7A6 D7E5I3 K7WW20 K9WVI5
WP_006196319.1.17284 WP_006196319.1.18086 WP_006196319.1.25658 WP_006196319.1.44637 WP_006196319.1.47433 WP_006196319.1.50365 WP_006196319.1.60463 WP_006196319.1.65595 WP_006196319.1.6664 WP_006196319.1.76008 WP_006196319.1.7687 WP_006196319.1.86392 WP_006196319.1.87691 gi|414077301|ref|YP_006996619.1| gi|298492489|ref|YP_003722666.1| gi|434404190|ref|YP_007147075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]