SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298492588|ref|YP_003722765.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492588|ref|YP_003722765.1|
Domain Number 1 Region: 160-286
Classification Level Classification E-value
Superfamily PIN domain-like 7.01e-23
Family PIN domain 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|298492588|ref|YP_003722765.1|
Domain Number - Region: 10-94
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0144
Family Clc chloride channel 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492588|ref|YP_003722765.1|
Sequence length 358
Comment PilT protein domain-containing protein ['Nostoc azollae' 0708]
Sequence
MLDIIIILSFILAASGIGYFSTDLLPPGTLDGVTNLNALRLIVAVFAAIIGGAIGLSFQT
TYRRLETQVREMPLEVILTRAIGLVIGLLLANLMLAPLFLLPIPPDFGFIKPLVAVVGSI
ILAVTGMNLADTHGRGLLRLINPNTVETMVVEGTLKPANTKVLDTSCIIDGRIETLLETG
FLEGVIIVPQFILQELQQVADASKDQKRVRGRRGLEILNRIKEAYPERILINAADYEDIA
TVDAKLVRFAQEINGTLLTNDYNLSKVASVQKVPVLNINDLVNAVRPSYLPGDNLDLKIL
KEGKEPSQGVGYLDDGTMVVVEEGSSYVGGELRVVVTSALQTSAGRMIFAKPQASALA
Download sequence
Identical sequences D7DW71
WP_013192653.1.25658 gi|298492588|ref|YP_003722765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]