SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298492888|ref|YP_003723065.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492888|ref|YP_003723065.1|
Domain Number 1 Region: 102-214
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.32e-30
Family Pentapeptide repeats 0.0012
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000000994
Family Chaperone J-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298492888|ref|YP_003723065.1|
Sequence length 222
Comment heat shock protein DnaJ domain-containing protein ['Nostoc azollae' 0708]
Sequence
MSELERYYRVLELEPGATLEEVNQAYKDLVFVWHPDRLPKDNQRLQQKAQDKLKAFNEAR
DKLRSLRDKSQTANNSKPTQQKKPSSSYNQPPQTNYQQPNQNPDLSGKDFSRANLSNRDL
SGRNLSYANLSGSNLSDTFMHKVNLRGADLSEANLFRANLLLADLREANLRSANLIGADL
SGADLRGADLTGARIRSGDRLLVKLIGANLAGAIMPDGAIHR
Download sequence
Identical sequences D7DY64
WP_013192952.1.25658 gi|298492888|ref|YP_003723065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]