SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298493037|ref|YP_003723214.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298493037|ref|YP_003723214.1|
Domain Number 1 Region: 202-399
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.18e-64
Family B3/B4 domain of PheRS, PheT 0.00000723
Further Details:      
 
Domain Number 2 Region: 36-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-45
Family Myf domain 0.0018
Further Details:      
 
Domain Number 3 Region: 487-700
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.96e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00011
Further Details:      
 
Domain Number 4 Region: 711-810
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.22e-31
Family Anticodon-binding domain of PheRS 0.00044
Further Details:      
 
Domain Number 5 Region: 415-494
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000201
Family Domains B1 and B5 of PheRS-beta, PheT 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298493037|ref|YP_003723214.1|
Sequence length 811
Comment phenylalanyl-tRNA synthetase subunit beta ['Nostoc azollae' 0708]
Sequence
MRISLTWLRELVEIKLSPEELAETLTIAGFEVEDIEDRRTWSNGVIVGKVLERQPHPNAD
KLSICQVDIGADETLNIVCGAANVRADIYVPVATTGTYLPKIDLKIKPAKLRGVPSNGMI
CSLKELGLPTDLDGIHIFTQENLSLGSDVRPLLGLDDVILNVTATANRADALSMVGIARE
VAALTGGQLSIPQLENVTIAQNTGNLTVKIRETQACPAYISTVIEQIKIAPSPEWLQQRL
RSAGVRPINNVVDITNYVLLEWGQPLHAFDKERLQSVASSENLTVGVRFADAGETLKTLD
GQTRTLSTQNLLITANNKAVALAGVMGGEETQVHESTQSLILEAALFDSVAIRRSSRSLG
LRSEASGRYERGVNRAELEIANNRALSLINELASGVILQQEIFDTRPDPSTWSHSILLRL
DRVNEVLGPIQSEEETGELEVDDVEKILTALGCELLKDEECTWKVTVPPYRYRDLEREID
LIEEIARLYGYDKFCDTLPDKAEAGYLSLDQELLRKIRSYLRAAGLTELIHYSLVKPGED
KQIVLSNPLFAEYSALRTDLIAGLIDACQYNIEQGNGMLNGFEIGRIFWREEEGLDEAEM
LAGIMGGDSTLGKWSRDGREQTLTWFEAKGILESVFRQFNLQVEFQPENRDSRLHPGRTA
SLWVRGIRLGTFGQVHPQLRREKSLPEAVYVFQLSLDVLLNTLDDDQLLVPKFQPFSTYP
ASDRDIAFFSPVKVTVSEIEKVITKAGKGLLDSVELFDEYRGENVPPGQRSLAFRLIYRS
IDHTLTDAEVEAVHNKVREALVEKFGVSLRS
Download sequence
Identical sequences D7DZ70
WP_013193101.1.25658 gi|298493037|ref|YP_003723214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]