SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298493063|ref|YP_003723240.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298493063|ref|YP_003723240.1|
Domain Number 1 Region: 141-322,457-611
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.09e-107
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000653
Further Details:      
 
Domain Number 2 Region: 24-127
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.77e-33
Family Anticodon-binding domain 0.00011
Further Details:      
 
Domain Number 3 Region: 319-452
Classification Level Classification E-value
Superfamily GAD domain-like 1.96e-31
Family GAD domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298493063|ref|YP_003723240.1|
Sequence length 618
Comment aspartyl-tRNA synthetase ['Nostoc azollae' 0708]
Sequence
MLDNGKALTFIHPSSPEKNELITMRTHYCGELRKEHIGETVTLYGWVDRRRDHGGVIFLD
LRDRSGIVQIVSDPQRTRESYEAANAIRNEYVVEITGRVTQRPAESLNPRIPTGELEIYA
DKIELLNAVRKQLPFQVSTADIETVREDLRLKYRYLDLRRERMAQNMQLRHQVVKAMRRY
LEDTEGFIEIETPVLTRSTPEGARDYILPSRVNEGEWFALPQSPQLFKQILMVSGMDRYY
QIARCFRDEDLRADRQPEFTQLDMEMSFMSENEIIELNEKLVCHIFKTVREIDLPHPFPR
LTYKEAMDKYGSDKPDTRYGLQLVDVSDVLKDSRFKVFNDAISKGGIVKILPIPNGNDVI
SNVRIKPGGDIFREAAEAGAKGLAYIRIRENGEIDTIGAIKDNLTPEQKEEIITRTGAKA
GHLLLFAAADTGTVNKTLDRIRQFVAREFNLIPPDKINFLWITEFPMFEWNAEQKGLEAL
HHPFTAPHPDDLQDLKTARAQAYDLVFNGFEVGGGSLRIYKREIQEQVFEAIGLSTEEAQ
NKFGFLLEAFEYGTPPHGGIAYGVDRLVMLLAEEESIRDVIAFPKTQQARCLLTDAPSAV
DTKQLKELHVASTFKPKL
Download sequence
Identical sequences D7DZ96
gi|298493063|ref|YP_003723240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]