SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298493078|ref|YP_003723255.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298493078|ref|YP_003723255.1|
Domain Number 1 Region: 142-360
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.37e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000901
Further Details:      
 
Domain Number 2 Region: 447-583
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00006
Further Details:      
 
Domain Number 3 Region: 13-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.23e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.004
Further Details:      
 
Domain Number 4 Region: 362-436
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.43e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|298493078|ref|YP_003723255.1|
Domain Number - Region: 592-635
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00217
Family Omega transcriptional repressor 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298493078|ref|YP_003723255.1|
Sequence length 637
Comment sulfite reductase, ferredoxin dependent ['Nostoc azollae' 0708]
Sequence
MVNTAPTSLTNRKPSRVEGIKENSNFLREPVATEILQDTTHFSEDAVQILKFHGSYQQDN
RDNRAKGQEKDYQMMLRTKNPGGLVPPQLYLALDQLADEYGNHTLRATTRQGFQIHGILK
KNLKSTITTIVGNLGSTLGACGDINRNVMAPAVPFKNRPEYLYAWEYAQNLADLLSPQTG
AYYEIWLDGEKAISAEEHPDVKAAREKNGNGTIIHDSVEPIYGTHYMPRKFKICVTVPGD
NSVDLYSQDLTLVVMTNKKGELQGFNVFAGGGLGRNHNKEETFARLADPICYVVKDDVYD
IVKAIVATQRDYGDRTDRRHARLKYLINDWGIDKFRAKVEEYFGKSVEPFKELPKFKYQD
FLGWNEQGDGKLFIGISIDNGRVKDEGKFQLKTALRSIVEQFNLPIRLTPNQNLIFYDIL
PEDKEAIQEILDKCGIIVDPTQIAALTRYAMACPALPTCGLAITESERAIPRILERIRAL
LDKLGLQKDHFVVRMTGCPNGCARPYMAELGFVGSAPESYQLWLGGSPDQTRLAQPIIEK
LHDNDIESFLEPIFVLFKKSRKGKESFGDFCDRTGFDAIREFSANYTPGEPTSSGKSRHR
VSLRDDVYLQLKETAEKQDRPMTELVHEALDKYFQSL
Download sequence
Identical sequences D7DZB1
gi|298493078|ref|YP_003723255.1| WP_013193141.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]