SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298501421|ref|YP_003723418.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298501421|ref|YP_003723418.1|
Domain Number 1 Region: 275-442
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-43
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 210-285
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000883
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|298501421|ref|YP_003723418.1|
Domain Number - Region: 9-60
Classification Level Classification E-value
Superfamily PUA domain-like 0.0447
Family SRA domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298501421|ref|YP_003723418.1|
Sequence length 444
Comment integral membrane sensor signal transduction histidine kinase ['Nostoc azollae' 0708]
Sequence
MERNPIFHQTRLRLAAWYTLVMGGILGLSSLGVYSVVAHAYYETIDQGLQSVANALHKSI
EPAWQQPGQLQRLNKEFSLELCVTQTSCLRTTTSIKKSIAEAANPVNYYIHLLDRSGKIF
ASGGMEVDNLSVTSVLDQWQISTDSSGNRYRKITLPLYTQDQVSGYLQVARSITDLDQHL
AYLRLVLVLGLPISMIFVGLSSWWLAGRAIQPVYFSYQQMQQFTADAAHEFRTPLAAMYS
TIEAAIKLQQKPKSNREILDVLKRQNRRLSQLVGDLLLLTRIDQEELTGEYQSCCLNDLI
SDLTEELAFLAVETKVNLSKQVQVLEKLYIIGNEEHLYRLISNLIANAIQATSSGGKVTI
LLEKSELYAIIKVQDTGIGIAVEHQQRIFDRFYRVDRDRSRISGGSGLGLAIAIAITRAH
KGNIQVQSQPGLGSTFIVRLPLSS
Download sequence
Identical sequences D7E5N6
gi|298501421|ref|YP_003723418.1|NC_014249 WP_013193304.1.25658 gi|298501421|ref|YP_003723418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]