SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298501431|ref|YP_003723428.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298501431|ref|YP_003723428.1|
Domain Number 1 Region: 8-437
Classification Level Classification E-value
Superfamily Clc chloride channel 3.27e-107
Family Clc chloride channel 0.00000245
Further Details:      
 
Domain Number 2 Region: 447-569
Classification Level Classification E-value
Superfamily CBS-domain pair 2.15e-31
Family CBS-domain pair 0.00088
Further Details:      
 
Domain Number 3 Region: 599-730
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.19e-17
Family Universal stress protein-like 0.03
Further Details:      
 
Domain Number 4 Region: 736-862
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000151
Family Universal stress protein-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298501431|ref|YP_003723428.1|
Sequence length 863
Comment Cl- channel voltage-gated family protein ['Nostoc azollae' 0708]
Sequence
MLARSKIFWLRLSRQLVKPRRLAFVEACVIGLVSGLAAVLLGQAVDWAGALRVRVSYHCP
AYLVLPSIGLVGGILAGWLVECFAPEASGSGMSEVKAVLARVPMPLNLRIALVKLISATL
VLGSGMPLGREGPTVQIGAALANQFSNWAPTSPEHRRQLIAAGAGAGLAAAFNAPIAGVL
FVVEELLQDVSGITLGTAILASFIASVISRLYGSHNLDLNHLNLGLPDTTFFAQEIPFYL
ILGVLAGFIGILFNKGILESLAINRRMVRLSLSWRIGIAGLVSGVVIALLPATFRDHAGL
REILLAGNTNWSFAAIALLVQFILIIFTYGSGAPGGLLVPTLVLGSALGYLVGAIEHSLL
GMSAAAVYAHVGMAAFFSAVSKVPITAVVIVFEMTTDFNLVLPLMIASVVAYLVAEKIDH
RSLYDLLLEWKGIHITKEPSREVLLAQLSAVDVMQRRLETLSSQMSTDEAVQAFSHSHHR
NFPVLENGKVVGIVTQEDLVNIASQKLSGDTTISEIMTPEPVTVTPTATLAHVLHILNRY
HLSCLLVTEGRKLIGIITRSDIIRVEAERLSGNSEQMERKLAPSYVVYQSRAPATGKGRL
LVPLSHPQTAETLLEMAVAIAKDRNYEIESLQVIIVPSSRIPSETPVQISKSLQLLQRAI
LLGENSRIPVHTEIRVAHNVAGAILETVKERHIDLVLMGWKGSTSTPGRVFSRVVDTIIR
QAGCDVILAKLDDKRSFDRWLLPIAGGPNSSQAIKLLPALSSLSRSSQINLCQVFQPNNS
IPDTTLLDKSVNFLQCRVSGKVVATPIRANSVSDAVLQCAEQDKSDVIVLGASCESLLQQ
AIQGNIAENISRKSNCTVIMVKT
Download sequence
Identical sequences D7E5P6
gi|298501431|ref|YP_003723428.1|NC_014249 WP_013193314.1.25658 gi|298501431|ref|YP_003723428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]