SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298490107|ref|YP_003720284.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490107|ref|YP_003720284.1|
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-27
Family ABC transporter ATPase domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 450-549
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 1.7e-24
Family Rad50 coiled-coil Zn hook 0.0037
Further Details:      
 
Domain Number 3 Region: 1-52,798-987
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.71e-22
Family ABC transporter ATPase domain-like 0.02
Further Details:      
 
Weak hits

Sequence:  gi|298490107|ref|YP_003720284.1|
Domain Number - Region: 713-824
Classification Level Classification E-value
Superfamily Hyaluronidase post-catalytic domain-like 0.034
Family Hyaluronidase post-catalytic domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490107|ref|YP_003720284.1|
Sequence length 1007
Comment exonuclease SbcC ['Nostoc azollae' 0708]
Sequence
MIPVQLILKNFLSYRDATLDFGGLHTACICGSNGAGKSSLLEAITWSIWGQSRATVEDDV
IYSGAKEVRVDFTFYNNQQTYRVIRTRARGATSILEFQIETPAGFRPLTRKGMRATQDVI
IQHIKLDYETFINSAYLRQGRADEFMLKRPTERKEILAELLKLDQYDVLEERAKDSSKLY
KGRAEELERSLDNIKVQLQQQETTKAQRVELESQLNSLQQQQALDNIQLQSLQVVEHKRQ
NWEQQLNFVWQQYQNLSQDCDRLHEEQLAVKSQLADLKVILNQAAEIIAGYAQYQSLQSQ
EEAFAVKSEQHTRATSFRQQQQQELTKQVQTIEYRFQQAQAQLEGLEQQEQEIQQTLTKS
SEVETALAQLASARKHLNYFDQLQMQVNPLLQQRLSLQNQLDRTRASLVARLEQLQATET
QLQSQYRRQPQLQQAALDVGIQIEELEKKRVYLQRVQEKGQERRHFIERLQVHQRDYEKL
LGELEQKLQVLQSPNALCPLCERHLDEHHWSRVIQKTQLEYEDTQGQFWVVREQMAVSDR
EIQVLRQEYREISQQLAGYDALREQRGQLAAKLQATTDVQEQLQQIALEREHLESSLQGD
YAPDKQVELQQLEQYLQQLNYNEQDHTLARSEVERWRWAEIKQAQIKDATKKQAQLAARK
PKLQATIDEFKLKIQLEQTDSDTAKQIEALTQEIKELNYSSEQHNKLRQAVRESQSWQLR
YQQFLSAQQKYPQLETRLEDLASSYKSRLADQQRFATQIDSIVEQLKATANPTEQINALE
QQIAIRRRELDEKIANLGRVEQLLHQLQTLQTQYVQEQEQLKYCQQQHRVYHELTQAFGK
NGIQALMIENVLPQLEAETNQLLSRLSANQLHVQFVTVKAGRSGKSTRKHTKLIDTLDIL
IADGRGTRAYETYSGGEAFRINFAIRLALAKLLAQRAGAALQLLIVDEGFGTQDNEGCDR
LIAAINAIASDFACILTVTHIPHLKEAFQARIEVNKTQQGSHIYLSI
Download sequence
Identical sequences D7E132
WP_013190179.1.25658 gi|298490107|ref|YP_003720284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]