SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620416|ref|YP_003708553.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620416|ref|YP_003708553.1|
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 5.62e-107
Family Tex N-terminal region-like 0.00000108
Further Details:      
 
Domain Number 2 Region: 314-462
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.28e-43
Family Tex RuvX-like domain-like 0.0000172
Further Details:      
 
Domain Number 3 Region: 630-717
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.21e-25
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 4 Region: 463-551
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.45e-24
Family Tex HhH-containing domain-like 0.0011
Further Details:      
 
Domain Number 5 Region: 553-624
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.78e-19
Family Tex HhH-containing domain-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297620416|ref|YP_003708553.1|
Sequence length 746
Comment hypothetical protein wcw_0172 [Waddlia chondrophila WSU 86-1044]
Sequence
MNQTHIAKISSELNLSIGRVGAALKLLEEGNTIPFIARYRKEMTDSLDEVQVREIKERSE
YLKGLDDRRLAILESIESQGKLTEELRSKIEACETKSALEDLYLPYKPKRRTKATIAREK
GLEPLAALIIAQGVDGNPEEDAAAFINAEKGVESAEQALEGARHIVAEWISEDAENRAFL
REAYQQDALLVSQAKEEWKEKDSKFKQYYDFSELVRKIPSHRYLAIRRGEQEMVLSVRLE
VEEEPILRELEKRARVSSSSPYSKQLKMAVEDSYRRLLSTSIESDVRVDLKMSSDRDAVE
IFEQNLRHLLLSPPMGNRSVIGIDPGLRTGCKCAAVSTTGKYLDSTTFYLTKGEKGLDQA
RNDFYRFVKKHTPFAIAIGNGTGNRETETFVKNLLSQSEMKEIIVVQVSECGASVYSASD
VAREEFPDLDLTIRGAVSIARRLQDPLAELVKVEPKSLGVGQYQHDVYQALLEKKLHDVV
ESCVNQVGVNLNTASPSLLSYVVGIGPSLSKKIVQFREERGEFKSRQQLMEVSGLGARAF
EQSAGFLRIQGGENPLDSSAVHPERYELVKQMAKDLGVTVEELVGDPKRAEAIDLGRYQS
GEVGFETLKDILDELKKPGRDPRKSFEPPKFRDDVTKIEDLKAGMELEGVVTNVTAFGAF
VDIGVHQDGLVHISELSDQFIKEPSDVVKAGDRLKVRVLDVDQKLKRISLSAKSKSKGTA
PIAKKKREQAPNQKKGAFSHHPFSSL
Download sequence
Identical sequences D6YTT6
gi|297620416|ref|YP_003708553.1| WP_013181275.1.19835 WP_013181275.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]