SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620448|ref|YP_003708585.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620448|ref|YP_003708585.1|
Domain Number 1 Region: 73-236,272-480
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.04e-71
Family (Uracil-5-)-methyltransferase 0.00054
Further Details:      
 
Weak hits

Sequence:  gi|297620448|ref|YP_003708585.1|
Domain Number - Region: 10-72
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000148
Family TRAM domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297620448|ref|YP_003708585.1|
Sequence length 482
Comment 23S rRNA (uracil-5-)-methyltransferase [Waddlia chondrophila WSU 86-1044]
Sequence
MSIRNKQCQVEVDIVNFSKKGNGIGYFLRQDEQTWPVEVSFAVPGDRVKTTLSRKRSGIY
RSRLDEIMAPSPDRIAPKCSHFGVCGGCRWQQMPYSKQLKEKELLIQHQFGHLLTDSVDL
YQIVPCDTPWNYRNKMEFSFSTDLEGNKYLGLMMDQGRGKVMDLQECHLTNPWFIETVSA
VRDWWEESELEAYHSYKDLGSLRTLTVREGIRTGDRMVNLTVSGNPDFALKKHHLEGFVA
FVRDAIEPVDPDKRLSIFLTIQQIKKGYPTQFYEMHLYGADTIREELHIQMLTEGGLEPL
LFHISPAAFFQPNTLQAEKLYSLALELAQISKEQVVYDLYCGTGTLGICAAKRAKQVVGV
ELSPESAHDARHNAKENRIENLTILTGAVRRVLEEIKEKELFPDPDVVMVDPPRAGLDPH
AIKHLLELGPPKIVYVSCNPATQVENVKEFLKDGYVLKAVQPVDQFPQTVHIENIVLLAK
KS
Download sequence
Identical sequences D6YTW8
gi|297620448|ref|YP_003708585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]