SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620472|ref|YP_003708609.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620472|ref|YP_003708609.1|
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.27e-19
Family eIF5a N-terminal domain-like 0.0044
Further Details:      
 
Domain Number 2 Region: 69-129
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000283
Family Cold shock DNA-binding domain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 131-188
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000135
Family Cold shock DNA-binding domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297620472|ref|YP_003708609.1|
Sequence length 189
Comment Elongation factor P [Waddlia chondrophila WSU 86-1044]
Sequence
MPQVSTSEFKSGMKIEVEGQPYVIVNNEFVKPGKGQAFNRVKLKHLLTARTIERTFKSGD
KVDLADVLETEMRMLYRDADGIVFMDDKTFEQITIPLDRIGDSDPWMMEDILYEVLIYNG
EPVSVEPPTFMELKITQTDPGERGDTASGKVLKPAETESGAKVQIPIFIEEGEVVKIDTR
TGEYVSRVN
Download sequence
Identical sequences D6YTZ2 F8LC36
gi|297620472|ref|YP_003708609.1| WP_013181331.1.19835 WP_013181331.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]