SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620545|ref|YP_003708682.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620545|ref|YP_003708682.1|
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.72e-46
Family Biotin holoenzyme synthetase 0.00045
Further Details:      
 
Domain Number 2 Region: 198-237
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000261
Family Biotin repressor (BirA) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297620545|ref|YP_003708682.1|
Sequence length 239
Comment biotin-[acetyl-CoA-carboxylase] ligase [Waddlia chondrophila WSU 86-1044]
Sequence
MLYKTFHFPNIDSTNTWALSNTHLFPRDKITLVYAKKQSEGRGRHKNQWTSPNANNLYAT
FGVFIPLEQGVQPNLPQLIALATISVMEKMGVQPKIKWPNDLLVQQKKIAGILTETSIDD
QHIFHAVGIGVNLNSSPDLPRPVTSLSAEIEREIDLEEFLDQLKETFSRFLSVFLDAGFS
PYLPAFKAHLNHHENQELSFHEKDCQWKGKFHSINDDGTLNLKLETGEVRRFIAGEILD
Download sequence
Identical sequences D6YU65 F8LAL4
gi|297620545|ref|YP_003708682.1| WP_013181404.1.19835 WP_013181404.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]