SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620635|ref|YP_003708772.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620635|ref|YP_003708772.1|
Domain Number 1 Region: 16-290
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.08e-69
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000188
Further Details:      
 
Domain Number 2 Region: 292-423
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.62e-25
Family Anticodon-binding domain of Class II aaRS 0.00015
Further Details:      
 
Domain Number 3 Region: 445-507
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.0000000000000785
Family C-terminal domain of ProRS 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297620635|ref|YP_003708772.1|
Sequence length 507
Comment prolyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
Sequence
MTQRREKTAITPTRQEDYPEWYQQVIKAADMAENSPVRGCMVIKPWGFGIWENIKSTLDQ
MIKETGHENVYFPLFIPLSFLEKEAAHVEGFAKECAVVTHHRLEEKDGKLIPTGELEEPL
IVRPTSETIIGDSFSRWVESYRDLPLLINQWANVVRWEMRPRIFLRTSEFLWQEGHTVHA
TKQEAKEETLKMLEVYRVLAEEVLAIPVILGEKSAGERFPGAESTYTLEMMMQDRKALQG
GTSHYLGQNFARAQGIQFSGKEGELEYAYTTSWGVTTRLIGGMIMCHGDDDGLRIPPRVA
PKQIVIIPVIPKPELEEEVLAFAEKVKQQIISQMFYGKPISVHIDKRDRRGGEKNWEWVK
KGVPVRIEIGPRDIESDSVMLARRDRGHKEKEKVSLETLGAIIPNLLNEIQKNYFEQAKA
FREMHIQRGVETLEALREFFTPKNPDKPEIHGGFVLAKWSEDPESEKILDEMKLTIRCLP
LSQSGTKGKCILTGKDAVKDVIIAKSY
Download sequence
Identical sequences D6YUF5 F8LEA3
WP_013181494.1.19835 WP_013181494.1.67671 gi|297620635|ref|YP_003708772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]